Offline

ts_anne

ts_anneis currently Offline. Expected back live in 4 hours.
In the meantime, 6 viewers are watching ts_anne live right now.
10

Preparing preview...

Now watching ts_anne on Chaturbate
Welcome to my Room!!! #Milf #boobs #ass #thick Cum Goal!!! [465 tokens remaining]
6 viewers
Join Live

Anne

Name: Anne
Age: 52
Gender: Trans
Location:
Followers: 5535
Viewers: 6
Languages:
Rank: 3357
Status: Offline
Last Online: 12 hours ago on 12 March '26
Welcome to my Room!!! #Milf #boobs #ass #thick Cum Goal!!! [465 tokens remaining]
Chaturbate's ts_anne gets you in the right kind of trouble. Expect seduction and crazy energy

Step into ts_anne's enticing domain. Watch superb shows on Chaturbate. This model is Trans. 52 years old. Status: Offline. Discover statistics to experience appealing masterpieces, spontaneous broadcasting moments, and an overpowering sweet magnetism enhanced by interactive energy

Over three years streaming, Anne's live broadcasts are pure mastery. In zir recent online show Anne once was in private chat over for over 2 hours

Zir cam data shows zie reached a top count of 5508 followers, early metrics documented a floor of 4327 followers, typical free-chat timeframe is 8 minutes, record indicates a maximum nonstop free chat time of 3.9 hours, Zir archives record 3197 free chat sessions, total recorded free chat time comes to 2.6 weeks, total cam activity is measured at 2.6 weeks online, performance archive notes an average private duration of 60 seconds. Records show zir maximum constant private time is 60 seconds. Zir track record confirm a total of 1 private sessions, logs reveal 60 seconds of private live session activity. This sultry model's record shows a peak of 15 viewers during a single show. Zir online cumshows have been seen by 2592 total viewers,

The last cam night spiked at 5508 followers. Zir follower meter touched 5506 at its lowest, piled up 2 follower additions on zir latest cam stream. On zir recent on-cam day, freechat averaged 7 minutes. Freechat hit its longest stretch 63 minutes on zir most recent online show. That recent cam event had 105 freechat sessions. On zir most recent day online, zie stayed in freechat for 12.8 hours. The last time zie went live, the timer read 12.8 hours. Zir last camshow floated around 12 viewers on average. Statistics list 6 viewers as the maximum on zir last active day. On zir most recent day online, zie recorded 12 total viewers

During the recent 30 day window, zie topped 5508 followers. Across the past 30 days, the slowest daily follower count was 5437. Across zir last 30 days of live exhibitions, zie gained 71 fans. In the last 30 days live, average freechat duration was 9 minutes. Over the past 30 days on screen, zir standout freechat ran 2.6 hours. During zir last month on screen, zie completed 275 freechat sessions. Across zir last 30 days of streaming, zie recorded 39.9 hours in freechat. Over zir last 30 days on cam, zir total live time was 39.9 hours. Over the most recent 30 days, zir viewership averaged 11. zir highest turnout over the recent 30 days reached 10. During zir last month of live sessions, 277 viewers checked in

ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate
ts_anne on Chaturbate

Total time

18d 9h 58mins
transyounganalprivatescamshowslivecamsebonygirlslivenicknamewhitefeednewguyscamstitsbigbabesmatureasscouple0sexymobileshowssexcamsasianbbwteenssimilarlatinmodelsxmlmilfs